PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30076.m004574
Common NameLOC8265895, RCOM_1343940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 1012aa    MW: 111889 Da    PI: 6.8376
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30076.m004574genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.81.2e-41156233178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqve+C adls+ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  30076.m004574 156 VCQVEDCGADLSSAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 233
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-33151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.3154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-39155236IPR004333Transcription factor, SBP-box
PfamPF031105.1E-30157230IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.3E-5783933IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.1E-6789931IPR020683Ankyrin repeat-containing domain
CDDcd002046.76E-5790897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1012 aa     Download sequence    Send to blast
MEARFGGEAQ AHHFYGMSAA DLRAVEKRSL EWDLNDWKWD GDLFIASPLN PVPSSNMSRQ  60
FFPIATGTPT NGNSSNSSSS CSDEVNLGIE KGKRELEKRR RVIVIEDDNL NDEGVGSLSL  120
KLGGHGFPVS EREIGNWEGN SGKKTKLVGG SMSRAVCQVE DCGADLSSAK DYHRRHKVCE  180
MHSKASKALV GNVMQRFCQQ CSRFHVLQEF DEGKRSCRRR LAGHNKRRRK TNPDTVGNAS  240
TLNDEQTSSY LLISLLKILS NMHSNRSDQV TDQDLLSHLL RSLASQSMEH GGKKLSGLLQ  300
EPRALLNGGT SFRNSEVFLT FILNALGLLR SLKLHLIVPF SGMSQRVLCS HGANGPNVQT  360
SSSMKPSIPN NYPAYSEVRD STAVQVKMNN FDLNDIYIDS DDGAEDIERS PVPTNMGTSS  420
LDCPSWIQQD SHQSSPPQTS GNSDSASAQS PSSSSGDAQS RTDRIIFKLF GKEPNDFPLV  480
LRAQILDWLS HSPTDIESYI RPGCVILTIY LRQAEAAWEE LCCNLSSSLS RLLDVSDNAF  540
WRTGWAYIRV QHQIAFIYNG QVVVDTSLPL RSNNHSKIAS VKPIAIPAAE RAQFVIKGIN  600
LSRPATRLLC AVEGKYMLQE NTEEMMDDID NINAHDELQC IKFCCSIPMV SGRGFIEIED  660
HGFSSSFFPF IVAEEDVCLE IRMLEGTLEF VGTDADLGGS GKIEAKNQAM DFINEIGWLL  720
HRSQLHSRLG HLNPCTDLFP LSRFKWLMEF SMDHEWCAVV TKLLNILHNG IVGTGEHSSL  780
NLALSEMGLL HRAVRKNSRS LVELLLRYVP EKSGPGNKLP VDGSHVNFLF RPDVTGPAGL  840
TPLHIAAGKD GSEDVLDALT DDPGMVGVEA WKKAHDSTGF TPEGYARLRG HYSYIHLVQK  900
KINKRPAAGH VVLDIPGTLS ECNVNQKQNE GVTASFEVGQ PAVRSIQRSC KLCHQKLDYG  960
TAGRSLLYRP AMLSMVAIAA VCVCVALLFK SCPEVVYVFR PFRWELLDFG TS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31150230484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197101KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515202.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLB9RN630.0B9RN63_RICCO; Putative uncharacterized protein
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1